PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03610.1.p
Common NameEUGRSUZ_F03610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 745aa    MW: 83831.2 Da    PI: 8.1659
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03610.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.85.1e-3076164291
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       fYn+YA+++GF +r+s  ++s+r+g++++r+ vCs+eg+r+   +  ++++r+r++tr+gCka+++vkk+++gkw v+k+++eHnHel+p
  Eucgr.F03610.1.p  76 FYNSYARRIGFGTRVSVYQRSRRDGSVVCRQVVCSREGFRRGGGEG-KSKKRRRTVTRVGCKAQMTVKKRSSGKWAVSKFVEEHNHELVP 164
                       ******************************************9999.9999*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2676164IPR004330FAR1 DNA binding domain
PfamPF105511.6E-15297361IPR018289MULE transposase domain
PROSITE profilePS5096610.608553587IPR007527Zinc finger, SWIM-type
PfamPF044341.2E-9561585IPR007527Zinc finger, SWIM-type
SMARTSM005758.6E-8562589IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDFEPVSIGN DVVEFEVGDS AGEDGGAGTG LDLGLGGRVE RPPSAGAGDT SGSDGDPGLE  60
PCEGMEFHSE QAARTFYNSY ARRIGFGTRV SVYQRSRRDG SVVCRQVVCS REGFRRGGGE  120
GKSKKRRRTV TRVGCKAQMT VKKRSSGKWA VSKFVEEHNH ELVPPDKVHC LRSHRHVPGP  180
ARSLIDTLQA AGMGPSGVMS VLIKESGGVN NVGFTKIDCQ NYMSSSRQRT LGSGGQLVLD  240
YLKQRQAADP GFFCAVQGDF DNLAGNIFWA DANSRKNYAY FGDTVNFDTS YRMNRYRPVL  300
FGCALLLNES ESSFIWLFQT WLDAMSGSHP VSITIDQDGI IRSAVAQVLP GTRHRFCRWN  360
VFREAQEKLS DVYCSNPNFE TEFQRCVNVP ETIEDFELCW ESLLERCGLR NNEWLQLMYN  420
ARQKWVPVFL RDTFFGEMSM MQGKDSINSY FDGYINASTS FQVLIRQYEN AIACRHEKEI  480
KSDYETLNTA PVLKTPSPME KQAANVYTRK IFKKFQGELV ETLAYPATII KDMESEAVYR  540
VAKFGEDHKA NFVKVDVFRK KACCSCQMFE FSGIMCRHIL AVFRVTNVLT LPPDYILKRW  600
TRNAKSESLL DDYMVGFTSN PQESFTARYE NLRIKAIKYV EDGAESIHSY TVAMDALQIA  660
AEKVAASKKH GFGLKQKTLI HGCQSQSRCT EQDEKIRELT SELANASLQC EEYQRKLLAV  720
LKDVEEQKLK ILVKVQNMRL NLKG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03610.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063175.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A059BWK50.0A0A059BWK5_EUCGR; Uncharacterized protein
STRINGVIT_18s0122g00530.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5